13411
The Flood / Re: Wednesday
« on: January 21, 2015, 06:32:48 AM »I remember that guyYeh
This section allows you to view all posts made by this member. Note that you can only see posts made in areas you currently have access to. 13412
The Flood / Re: This... Cancer....« on: January 21, 2015, 06:30:54 AM »
Are those smell lines?
13413
The Flood / Re: Rindfleischetik...« on: January 21, 2015, 06:29:46 AM »Yeah... If you could chop the other thread's title in half too, that'd be great.This coming from ze german name guy! The Fatherland sheds a single tear. 13414
The Flood / Re: Post your My Pictures folder« on: January 21, 2015, 05:48:57 AM »
I would but I'm messy. I just leave my stuff laying around anywhere. If I have a dedicated folder it's probably my imgur.
13416
The Flood / Re: Rindfleischetik...« on: January 21, 2015, 05:31:12 AM »Case in point.What?Humour is great, isn't it?And wait just a minute LOL There's a difference between joking around and just being an insecure shithead like Oss. Which, coincidentally, is why Kiyo is gone and I'm still here. Personality. I like you, dude, but your sense of humour consists of anime gifs, cheap memes and all caps. It isn't the greatest. You came into this thread not understanding the humour. Which is what you do most of the time. "Ok." "What." -Byrne, 2014 - present Edit: Addendum: Lol. But you should read this, it'll help you. 13417
The Flood / Re: Rindfleischetik...« on: January 21, 2015, 05:21:56 AM »Humour is great, isn't it?And wait just a minute LOL Did you, Mr Stick-in-my-butt-Byrne, just try to tell me about humour? This is worse than when mad max got all 'relaxed' yesterday. 13418
The Flood / Re: Donaudampfschifffahrtsgesellschaftskapitaenswitwe« on: January 21, 2015, 05:18:50 AM »Huh, neatIt's because it's not an established word, but in Swedish, as in German, you can make compound words by putting several words together.Kraftledningsstolpsinstallatörsuniformstvättaregoogle gives me nothing 13419
The Flood / Re: Rindfleischetik...« on: January 21, 2015, 05:18:05 AM »jokes make us laughHumour is great, isn't it?your logical fallacy is: slippery slopeThen again, English words don't always imply genocidal sentiments towards jews and blacks, which is an inherent element of all German words.If it was a long english title you wouldn't have touched it. Fact.No can do, sorry.Can't we just let it interfere?You can edit it or change it yourself, if you want. Just nothing too long, as apparently it interferes with the mobile version of the site.Edited the title for mobile browsing purposes. Long titles mess things up quite a bit. Something to look into in the future.I wouldn't usually say this, but that's racist. 13420
The Flood / Re: Rindfleischetik...« on: January 21, 2015, 05:10:04 AM »your logical fallacy is: slippery slopeThen again, English words don't always imply genocidal sentiments towards jews and blacks, which is an inherent element of all German words.If it was a long english title you wouldn't have touched it. Fact.No can do, sorry.Can't we just let it interfere?You can edit it or change it yourself, if you want. Just nothing too long, as apparently it interferes with the mobile version of the site.Edited the title for mobile browsing purposes. Long titles mess things up quite a bit. Something to look into in the future.I wouldn't usually say this, but that's racist. 13421
The Flood / Re: Donaudampfschifffahrtsgesellschaftskapitaenswitwe« on: January 21, 2015, 05:08:40 AM »Kraftledningsstolpsinstallatörsuniformstvättaregoogle gives me nothing 13422
The Flood / Re: Donaudampfschifffahrtsgesellschaftskapitaenswitwe« on: January 21, 2015, 05:07:46 AM »"widow of a Danube steamboat company captain"It honestly looks like someone spazzed out on a keyboard.They probably think so too. 13423
The Flood / Re: Rindfleischetik...« on: January 21, 2015, 05:06:42 AM »If it was a long english title you wouldn't have touched it. Fact.No can do, sorry.Can't we just let it interfere?You can edit it or change it yourself, if you want. Just nothing too long, as apparently it interferes with the mobile version of the site.Edited the title for mobile browsing purposes. Long titles mess things up quite a bit. Something to look into in the future.I wouldn't usually say this, but that's racist. 13424
The Flood / Re: Rindfleischetik...« on: January 21, 2015, 04:54:19 AM »Can't we just let it interfere?You can edit it or change it yourself, if you want. Just nothing too long, as apparently it interferes with the mobile version of the site.Edited the title for mobile browsing purposes. Long titles mess things up quite a bit. Something to look into in the future.I wouldn't usually say this, but that's racist. Blitzkrieg? 13425
The Flood / Re: Rindfleischetikettierungsueberwachungsaufgabenuebertragungsgesetz« on: January 21, 2015, 04:53:26 AM »"law delegating beef label monitoring"...Ok?Used to be the longest word in the German language. 13426
The Flood / Re: Donaudampfschifffahrtsgesellschaftskapitaenswitwe« on: January 21, 2015, 04:51:13 AM »13427
The Flood / Re: Rindfleischetik...« on: January 21, 2015, 04:50:27 AM »Edited the title for mobile browsing purposes. Long titles mess things up quite a bit. Something to look into in the future.I wouldn't usually say this, but that's racist. You can't just cut a word in half. 13428
The Flood / Re: Rindfleischetikettierungsueberwachungsaufgabenuebertragungsgesetz« on: January 21, 2015, 04:49:24 AM »13429
The Flood / Donaudampfschifffahrtsgesellschaftskapitaenswitwe« on: January 21, 2015, 04:46:22 AM »![]() 13430
The Flood / Rindfleischetik...« on: January 21, 2015, 04:42:29 AM »
Rindfleischetikettierungsueberwachungsaufgabenueb ertragungsgesetz
R.I.P. ![]() 13431
The Flood / Re: Hey Flee« on: January 21, 2015, 04:39:33 AM »Good to hear it.Do you take medication?I'm all natural baby. 13433
The Flood / Re: Wednesday« on: January 21, 2015, 03:25:38 AM »I don't watch Tennis but I had classes for a while. Heaps of fun.Australian Open mate.This is the only time of the year I wish I lived in Australia.Why's that? 13434
The Flood / Re: Wednesday« on: January 21, 2015, 03:18:45 AM »Hot or cold, you're going to suffer a little of something either way.It's cold in Europe.This is the only time of the year I wish I lived in Australia.Why's that? 13435
The Flood / Re: Wednesday« on: January 21, 2015, 03:07:31 AM »This is the only time of the year I wish I lived in Australia.Why's that? 13436
Interrogator: When did you first decide to contact Stark? Before or after Bliss?
Finch: I was just investigating two deaths. Following orders. I: And to you that meant scheming with all of the city's enemies? F: No, that's not it at all. That you- [screams, garbled recording] F: Why did you do that? Why? I'm talking. I'm talking. I: But you're not saying anything. 13437
The Flood / Re: My favourite sequence from Zoids.« on: January 21, 2015, 12:53:17 AM »you're going to make me marathon Zoids, you bastard.Such a solid series, I need to watch it again too. 13439
The Flood / My favourite sequence from Zoids.« on: January 21, 2015, 12:15:58 AM »
From Chaotic Century. New Century was lame. Sharing it because I found it on youtube.
YouTube |