Show Posts

This section allows you to view all posts made by this member. Note that you can only see posts made in areas you currently have access to.


Messages - Elegiac

Pages: 1 ... 446447448 449450 ... 789
13411
The Flood / Re: Wednesday
« on: January 21, 2015, 06:32:48 AM »

13412
The Flood / Re: This... Cancer....
« on: January 21, 2015, 06:30:54 AM »
Are those smell lines?

13413
The Flood / Re: Rindfleischetik...
« on: January 21, 2015, 06:29:46 AM »
Yeah... If you could chop the other thread's title in half too, that'd be great.
I don't feel like bumping it to say it there
This coming from ze german name guy! The Fatherland sheds a single tear.

13414
The Flood / Re: Post your My Pictures folder
« on: January 21, 2015, 05:48:57 AM »
I would but I'm messy. I just leave my stuff laying around anywhere. If I have a dedicated folder it's probably my imgur.

13415
The Flood / Re: Look at this perfection
« on: January 21, 2015, 05:44:05 AM »

13416
The Flood / Re: Rindfleischetik...
« on: January 21, 2015, 05:31:12 AM »
Humour is great, isn't it?
And wait just a minute LOL

Did you, Mr Stick-in-my-butt-Byrne just try to tell me about humour? This is worse than when mad max got all 'relaxed' yesterday.
What?
I don't freak out when someone 'Likes' a post I disagree with, or tell people to kill themselves because I got butthurt.

I'm great with humour, you, not so much.
Case in point.

There's a difference between joking around and just being an insecure shithead like Oss. Which, coincidentally, is why Kiyo is gone and I'm still here. Personality. I like you, dude, but your sense of humour consists of anime gifs, cheap memes and all caps. It isn't the greatest. You came into this thread not understanding the humour. Which is what you do most of the time.

"Ok."

"What."

 -Byrne, 2014 - present

Edit: Addendum: Lol. But you should read this, it'll help you.

13417
The Flood / Re: Rindfleischetik...
« on: January 21, 2015, 05:21:56 AM »
Humour is great, isn't it?
And wait just a minute LOL

Did you, Mr Stick-in-my-butt-Byrne, just try to tell me about humour? This is worse than when mad max got all 'relaxed' yesterday.

13418
The Flood / Re: Donaudampfschifffahrtsgesellschaftskapitaenswitwe
« on: January 21, 2015, 05:18:50 AM »
Kraftledningsstolpsinstallatörsuniformstvättare
google gives me nothing
It's because it's not an established word, but in Swedish, as in German, you can make compound words by putting several words together.

It means "Power line pole installer uniform washer". So it's the person who washes the uniforms of people who install poles for power lines.
Huh, neat

13419
The Flood / Re: Rindfleischetik...
« on: January 21, 2015, 05:18:05 AM »
Edited the title for mobile browsing purposes. Long titles mess things up quite a bit. Something to look into in the future.
I wouldn't usually say this, but that's racist.

You can't just cut a word in half.
You can edit it or change it yourself, if you want. Just nothing too long, as apparently it interferes with the mobile version of the site.
Can't we just let it interfere?

Blitzkrieg?
No can do, sorry.
If it was a long english title you wouldn't have touched it. Fact.
Then again, English words don't always imply genocidal sentiments towards jews and blacks, which is an inherent element of all German words.
your logical fallacy is: slippery slope
Humour is great, isn't it?
jokes make us laugh

13420
The Flood / Re: Rindfleischetik...
« on: January 21, 2015, 05:10:04 AM »
Edited the title for mobile browsing purposes. Long titles mess things up quite a bit. Something to look into in the future.
I wouldn't usually say this, but that's racist.

You can't just cut a word in half.
You can edit it or change it yourself, if you want. Just nothing too long, as apparently it interferes with the mobile version of the site.
Can't we just let it interfere?

Blitzkrieg?
No can do, sorry.
If it was a long english title you wouldn't have touched it. Fact.
Then again, English words don't always imply genocidal sentiments towards jews and blacks, which is an inherent element of all German words.
your logical fallacy is: slippery slope

13421
The Flood / Re: Donaudampfschifffahrtsgesellschaftskapitaenswitwe
« on: January 21, 2015, 05:08:40 AM »
Kraftledningsstolpsinstallatörsuniformstvättare
google gives me nothing

13422
The Flood / Re: Donaudampfschifffahrtsgesellschaftskapitaenswitwe
« on: January 21, 2015, 05:07:46 AM »
It honestly looks like someone spazzed out on a keyboard.

Sorry Germans of Sep7...
They probably think so too.
"widow of a Danube steamboat company captain"

13423
The Flood / Re: Rindfleischetik...
« on: January 21, 2015, 05:06:42 AM »
Edited the title for mobile browsing purposes. Long titles mess things up quite a bit. Something to look into in the future.
I wouldn't usually say this, but that's racist.

You can't just cut a word in half.
You can edit it or change it yourself, if you want. Just nothing too long, as apparently it interferes with the mobile version of the site.
Can't we just let it interfere?

Blitzkrieg?
No can do, sorry.
If it was a long english title you wouldn't have touched it. Fact.

13424
The Flood / Re: Rindfleischetik...
« on: January 21, 2015, 04:54:19 AM »
Edited the title for mobile browsing purposes. Long titles mess things up quite a bit. Something to look into in the future.
I wouldn't usually say this, but that's racist.

You can't just cut a word in half.
You can edit it or change it yourself, if you want. Just nothing too long, as apparently it interferes with the mobile version of the site.
Can't we just let it interfere?

Blitzkrieg?

13425
...Ok?
Used to be the longest word in the German language.
"law delegating beef label monitoring"

13427
The Flood / Re: Rindfleischetik...
« on: January 21, 2015, 04:50:27 AM »
Edited the title for mobile browsing purposes. Long titles mess things up quite a bit. Something to look into in the future.
I wouldn't usually say this, but that's racist.

You can't just cut a word in half.

13429
The Flood / Donaudampfschifffahrtsgesellschaftskapitaenswitwe
« on: January 21, 2015, 04:46:22 AM »
:)

13430
The Flood / Rindfleischetik...
« on: January 21, 2015, 04:42:29 AM »
Rindfleischetikettierungsueberwachungsaufgabenueb ertragungsgesetz

R.I.P.

:(

13431
The Flood / Re: Hey Flee
« on: January 21, 2015, 04:39:33 AM »

13432
The Flood / Re: Hey Flee
« on: January 21, 2015, 04:34:17 AM »
Do you take medication?

13433
The Flood / Re: Wednesday
« on: January 21, 2015, 03:25:38 AM »
This is the only time of the year I wish I lived in Australia.
Why's that?
Australian Open mate.
I don't watch Tennis but I had classes for a while. Heaps of fun.

13434
The Flood / Re: Wednesday
« on: January 21, 2015, 03:18:45 AM »
This is the only time of the year I wish I lived in Australia.
Why's that?
It's cold in Europe.
Hot or cold, you're going to suffer a little of something either way.

13435
The Flood / Re: Wednesday
« on: January 21, 2015, 03:07:31 AM »
This is the only time of the year I wish I lived in Australia.
Why's that?

13436
The Flood / Wednesday
« on: January 21, 2015, 03:01:42 AM »
Interrogator: When did you first decide to contact Stark? Before or after Bliss?

Finch: I was just investigating two deaths. Following orders.

I: And to you that meant scheming with all of the city's enemies?

F: No, that's not it at all. That you-

[screams, garbled recording]

F: Why did you do that? Why? I'm talking. I'm talking.

I: But you're not saying anything.

13437
The Flood / Re: My favourite sequence from Zoids.
« on: January 21, 2015, 12:53:17 AM »
you're going to make me marathon Zoids, you bastard.
Such a solid series, I need to watch it again too.

13438
The Flood / Re: My favourite sequence from Zoids.
« on: January 21, 2015, 12:25:29 AM »

13439
The Flood / My favourite sequence from Zoids.
« on: January 21, 2015, 12:15:58 AM »
From Chaotic Century. New Century was lame. Sharing it because I found it on youtube.

YouTube

13440
The Flood / Re: I'm the true God
« on: January 20, 2015, 11:57:11 PM »
#truth

Pages: 1 ... 446447448 449450 ... 789