Show Posts

This section allows you to view all posts made by this member. Note that you can only see posts made in areas you currently have access to.


Topics - Elegiac

Pages: 1 ... 282930 3132 ... 59
871
The Flood / Shoe Thread.
« on: January 23, 2015, 07:02:13 AM »
What type of shoes do you wear, and what type of shoes do you prefer?

I wear cheap knock-off chuck taylor all stars in various colours.

872
The Flood / The Final Battle of Sep7agon Memes.
« on: January 23, 2015, 06:06:09 AM »
From the dark land of Bootyor, Lord Camnator sends forth his booty horde; from the White City of the Waifu have marched Tru and the men of the Waifu. All the while Elegiac and Gatsby carry the Boypussy ever closer to the fires of Mount Nutella.

Who will triumph? Will Sep7agon become pure and white, or dark and twerking?

873
The Flood / What type of thread am I allowed to make now?
« on: January 23, 2015, 02:23:57 AM »
If I'm not allowed to make any threads now, would you just come out and say it instead of jerkin' me around? The last thread I made was a genuine discussion.

874
Like it or not, I'm allowed to make music threads, and those threads only had a very slim relation. You were reaching. And now you've taken a big shit on that persons thread. I'm sure they really appreciate it since my song has no video.

Don't touch my stuff. Consider yourself warned.

875
The Flood / Goodnight, Flood.
« on: January 22, 2015, 02:53:36 PM »
See you tomorrow, bright-eyed and bushy-tailed.


876
The Flood / Friday
« on: January 22, 2015, 01:47:28 PM »

Interrogator: When did you first realise how deeply you were involved?

Finch: I didn't. I mean, it wasn't clear. I mean, I never did.

I: That is a lie. You're hiding things again.

F: Then kill me and use a memory bulb to find out the truth.
Bastard.

I: We can only kill you once. And once you are dead, all we would
have is your bulb. They're unreliable.

F: Then trust me.

I: People lie. They lie and they keep lying. Eventually, they can't
remember the truth. Is that your problem, Finch?

F: I'm not really a detective. That's why I can't answer your
questions.

I: Once they made you a detective, you were a detective. Why did you
never understand that?

877
The Flood / Screen Man
« on: January 22, 2015, 10:54:24 AM »
Music Thread.

Spoiler
YouTube

878
The Flood / sup bitches
« on: January 22, 2015, 10:26:55 AM »
talk at me a little

879
The Flood / finch is too fucked up
« on: January 22, 2015, 09:20:59 AM »
I feel as fucked as he does right now, if the books description is anything to go by, but he just tackled some cunt through a time portal into the middle of the next day, kicked the shit out of him and questioned him, then found out his friend has been partnered with the wimpiest detective in their station and has been sent off to investigate a rebel stronghouse on a virtual suicide mission by their occupying psychedelic mind-melting mushroom-man overlords; so now he's off to help them

What am I doing with my life, why can't I be living in a hardcore alternate reality where I'm not ruled by the McDonalds happymeal equivalent of villains, who are only in charge and anally raping the human race because we're all so fucking trough-fed and lazy

880
The Flood / Debra
« on: January 22, 2015, 06:59:10 AM »
Music Thread.

Spoiler
YouTube

881
The Flood / Into yer shtick
« on: January 22, 2015, 06:20:43 AM »
Music Thread.

Spoiler
YouTube

882
The Flood / I don't find blue girls attractive
« on: January 22, 2015, 01:26:03 AM »
fuckin bitches


883
The Flood / I would like to thank Gasai.
« on: January 22, 2015, 12:45:51 AM »
For allowing her fellow deities in the Trinity of Threadmakers to catch up. You have brought balance to the Force.

884
The Flood / Daylight
« on: January 21, 2015, 11:57:49 PM »
Music Thread.

Spoiler
YouTube

I've got a catacomb with fur covered styrofoam.
So come over now and sleep.
Time isn't here again, wasted thoughts that could've been.
Now we can devise our plan.

Daylight, daylight.
Daylight won't find us here.

I've got a catacomb with flags that flew fifty years ago.
Let sleep overcome your mind.
God isn't safe again, molest trees and chop down men.
So we must revise our plan.

Daylight, daylight.
Daylight won't find us here.
Daylight, daylight.
Daylight won't find us here.
Daylight, daylight.
Daylight won't find us here.

885
The Flood / *frisking*
« on: January 21, 2015, 01:56:24 PM »
sup


886
The Flood / Thursday
« on: January 21, 2015, 11:16:01 AM »

Interrogator: Why do you hate Partials?

Finch: I don't hate them.

I: We all have a job to do.

F: I don't like cameras.

I: Where did you go during the party?

F: Nowhere. Home. I went home.

I: You were seen on the street after curfew. By a Partial.

F: It was someone else. No. No. Please. Don't! [sounds of weeping] I
didn't go anywhere. I don't remember.

I: Who was it? Stark? The Lady in Blue? Bliss? Someone else?

F: All of them. None of them. Doesn't matter what answer I give. Your
answer is always the fucking same.

I: I can make you remember.

887
The Flood / actually
« on: January 21, 2015, 09:49:42 AM »
not even I care to be honest

888
The Flood / gotta go slow
« on: January 21, 2015, 08:16:24 AM »
took me seven minutes to type this

piss off

889
The Flood / Production Model Thread.
« on: January 21, 2015, 07:44:13 AM »
Forum worthy, red hot and ready to roll. Hit that reply button, you're gonna love the way this baby handles.

890
The Flood / Choose wisely (for me).
« on: January 21, 2015, 07:04:15 AM »
This is my last night on bagged tea before I resupply my stores of quality loose leaf tomorrow. I'm down to the last two boxes of tea. What should I partake of? Quick! Go go go

891
The Flood / Donaudampfschifffahrtsgesellschaftskapitaenswitwe
« on: January 21, 2015, 04:46:22 AM »
:)

892
The Flood / Rindfleischetik...
« on: January 21, 2015, 04:42:29 AM »
Rindfleischetikettierungsueberwachungsaufgabenueb ertragungsgesetz

R.I.P.

:(

893
The Flood / Wednesday
« on: January 21, 2015, 03:01:42 AM »
Interrogator: When did you first decide to contact Stark? Before or after Bliss?

Finch: I was just investigating two deaths. Following orders.

I: And to you that meant scheming with all of the city's enemies?

F: No, that's not it at all. That you-

[screams, garbled recording]

F: Why did you do that? Why? I'm talking. I'm talking.

I: But you're not saying anything.

894
The Flood / My favourite sequence from Zoids.
« on: January 21, 2015, 12:15:58 AM »
From Chaotic Century. New Century was lame. Sharing it because I found it on youtube.

YouTube

895
The Flood / Dogs.
« on: January 20, 2015, 08:30:34 PM »
Article.

Quote
Dogs are also the only non-primate animal to look people in the eyes. This is something Andics, along with other researchers, discovered about a decade ago when he studied the domestication of wolves, which he thought would share that trait. They endeavored to raise wolves like dogs. This is a unique behavior between dogs and humans — dogs seek out eye contact from people, but not their biological dog parents.

896
The Flood / The banners got smaller.
« on: January 20, 2015, 02:30:43 PM »
I notice these things.

897
The Flood / Defence with a C
« on: January 20, 2015, 01:22:38 PM »
Do americans really spell 'defence' with an s? How didn't I notice that before? Sorry, but that's too much. Taking the 'u' out of words sort of makes sense, even if it's ugly. But defense?

"Uhhhhh, duh c makin' a sss noise, so puttin' an s dere. Duhhhhhhh."

I imagine that's how it came about. And the guy was riding a negro, riding a horse, on a paddle steamer with a stalk of wheat between his teeth. Now that I think about it you guys are responsible for the descent of the english language into a collection of acronyms as well, imho, lmao goml.


898
The Flood / Tuesday
« on: January 20, 2015, 12:59:20 PM »
Interrogator: The fanaarcensittii. You said he had fallen from a great height. Did
anything you saw in the memory bulbs support that idea?

Finch: Instinct. I didn't trust what I saw.

I: Why not?

F: Because I haven't felt the same since I ate them. Because they were
scenes out of a nightmare. I don't know.

I: There's one strange thing in all of this.

F: Just one?

I: A mention of a fortress. In a desert. Do you know the name of this
place?

F: No.

I: I think you do.

F: I don't even know if it was real or not.

I: Is this real?

[screams]

899
The Flood / When they give you things, ask yourself why.
« on: January 20, 2015, 08:31:59 AM »
When you're grateful to them for giving you the things
you should have anyway, ask yourself why.



Interrogator: What did you see then?

Finch: Nothing. I couldn't see anything.

I: Wrong answer.

[howls and screams and sobbing]

I: Had you ever met the Lady in Blue before?

F: No, but I'd heard her before.

I: Heard her where?

F: On the fucking radio station, that's where.

[garbled comment, not picked up]

F: It's her voice. Coming up from the underground. People say.

I: So what did you see, Finch?

F: Just the stars. Stars. It was night.

I: I can ask you this same question for hours, Finch.

F: You wanted me to say I saw her! I said it, damn you.

I: There is no Lady in Blue. She's just a propaganda myth from the rebels.

F: I saw her. On the hill. Under the stars.

I: What did this apparition say to you, Finch? What did this vision say?



Pages: 1 ... 282930 3132 ... 59